| Bid |
Type |
Language / Subject |
| 0 | Sell | GHRH 1-44
...4 amino acids in most species that stimulates the release and synthesis of GROWTH HORMONE. GHRF (or GRF) is synthesized by neurons in the ARCUATE NUCLEUS of... Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular Formula
C 215 H 358 N 72 O66 S
Molecular Weight
5039.76
Purity (HPLC) 9...
Posted on: 2015-11-19 from China - Shanghai
|
  |
| 0 | Sell | Sermorelin (GRF1-29)
...corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residu... ...-Leu-Ser- Ala -Arg- Lys -Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH 2
Molecular Formula
C149H246N44O42S
Molecular Weight
3357.96
Description
Sermoreli...
Posted on: 2015-11-16 from China - Shanghai
|
| |
| 0 | Sell | Ghrp6
...y (HPLC) 98% min
Description
It has strong effect on the release of Growth Hormone (GH). Its main use is to promote food intake by stimulating hunger... ...S No. 87616-84-0
Sequence
His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
Molecular Formula
C 46 H 56 N 12 O 6
Molecular Weight
873.01
Purity (HPLC) 98% m...
Posted on: 2015-11-16 from China - Shanghai
|
| |
| 0 | Sell | CJC-1295
... (HPLC) 95% min
Description
CJC-1295 is a synthetic modification of growth hormone releasing factor (GRF) with D-Ala, Gln, Ala, and Leu substitutions... ... -Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula
C 152 H 252 N 44 O 42
Molecular Weight
3368
Purity (HPLC) 95%...
Posted on: 2015-11-16 from China - Shanghai
|
| |
| 0 | Sell | Organic fertilizer, Organic compound fertilizer, organic amino acid fert
...organic-inorganic mixed fertilizer formula based on soil ecology and plant growth nutriology, is made by adopting advanced bio-fermentation technique and de... Ertilizer
Amino acid organic-inorganic mixed fertilizer formula based on soil ecology and plant growth nutriology, is made by adopting adv...
Posted on: 2015-07-30 from China - Shandong
|
|
|
|
| 0 | Sell | Looking for Agent and importer for health care and skinny care product
...clear spray
Effecient formula for healthy hair and scalp. Stimulate hair growth by enhancing peripheral circulation. Potent Anti-inflammatory formula. ... ...rter for health care and skinny care product
Fizzy clear spray
Effecient formula for healthy hair and scalp. Stimulate hair growth by enhancing peripheral...
Posted on: 2012-09-07 from Egypt - Al Gharbiyah
|
 |
| 0 | Sell | Natural eyelash growth enhancer USD6.0/box
...hair follicle germ tissue which is in dormancy condition. Then boost rapid growth of eyelash. Ingredients
EPM, purified water, Vitamins, citric acid, col... ...al Eyelash Enhancer
Lengthen eyelash 2-3mm in 7 days
100% pure botanical formula, No drug, no harm
No work, REFUND. Products detail
EPM was developed ...
Posted on: 2013-07-25 from China - Yunnan
|
|
| 0 | Sell | Natural eyelash growth serum
...hair follicle germ tissue which is in dormancy condition. Then boost rapid growth of eyelash. Ingredients
EPM, purified water, Vitamins, citric acid, col... ...al Eyelash Enhancer
Lengthen eyelash 2-3mm in 7 days
100% pure botanical formula, No drug, no harm
No work, REFUND. Products detail
EPM was developed ...
Posted on: 2013-07-25 from China - Yunnan
|
|
| 0 | Sell | Lash growth enhancer product
...hair follicle germ tissue which is in dormancy condition. Then boost rapid growth of eyelash. Ingredients
EPM, purified water, Vitamins, citric acid, col... ...al Eyelash Enhancer
Lengthen eyelash 2-3mm in 7 days
100% pure botanical formula, No drug, no harm
No work, REFUND. Products detail
EPM was developed ...
Posted on: 2013-07-25 from China - Yunnan
|
|
| 0 | Sell | FEG eyelash enhancer mascara USD6.0/PC
...shes dramatically enhancing the thickness, fullness and length of new lash growth without the use of prostaglandins, which have been shown to cause skin dar... ...al Eyelash Enhancer
Lengthen eyelash 2-3mm in 7 days
100% pure botanical formula, No drug, no harm
No work, REFUND. Function
Nourish and revives your l...
Posted on: 2013-07-25 from China - Yunnan
|
|
| 0 | Sell | Eyelash growth enhancer natural cosmetic product
... work, REFUND. Dosage
After cleansing, use bristles extract the eyelash growth liquid, smear the eyelash from the eyelash root ministry to the top. Use t... ...al Eyelash Enhancer
Lengthen eyelash 2-3mm in 7 days
100% pure botanical formula, No drug, no harm
No work, REFUND. Dosage
After cleansing, use bristle...
Posted on: 2013-07-25 from China - Yunnan
|
|
| 0 | Sell | Lash growth enhancer USD6.0/PC
...g..
Dosage
After cleansing, use bristles extract the eyelash growth liquid, smear the eyelash from the eyelash root ministry to the top. Use t... 2012 latest herbal formula eyelashes enhancer lengthening your eyelashes 2-3mm in 7 days
Products ...
Posted on: 2013-07-25 from China - Yunnan
|
|
| 0 | Sell | Eyelash enhancer mascara
...hair follicle germ tissue which is in dormancy condition. Then boost rapid growth of eyelash. Ingredients
EPM, purified water, Vitamins, citric acid, col... ...al Eyelash Enhancer
Lengthen eyelash 2-3mm in 7 days
100% pure botanical formula, No drug, no harm
No work, REFUND. Products detail
EPM was developed ...
Posted on: 2013-07-25 from China - Yunnan
|
|
| 0 | Sell | FEG eyelash growth 100% Natural herbal formula eyelash enhancer
Rich in growth factor, activate
follicular cell. Function FEG can activate
dormant h... ...after 20 days’ usage of the
product. Comprehensive nutrition, natural
formula
Dosage Apply nightly directly to
the skin of the upper eyelid
margin ...
Posted on: 2013-08-15 from China - Zhejiang
|
|
| 0 | Sell | Water Soluble Fertilizer
...ers wide range of formula and all the nutrients to suit most crops and all growth stages, and will promote plants to grow better and healthier, thus ensurin... ...er is essential for successful fetigation program. It covers wide range of formula and all the nutrients to suit most crops and all growth stages, and will p...
Posted on: 2013-04-24 from China - Hebei
|
|
| 0 | Sell | Looking for agent for wolrd highest quality baby formula
...e likely to sleep longer, so this formula plays an important part in their growth & development. And you are comfortable knowing that the main ingredients ... ...e International Ltd is a specialist exporter of the finest Infant and Baby Formulas - developed, manufactured, and packaged in New Zealand; a world
leader...
Posted on: 2012-11-01 from China - Shanghai
|
|
| 0 | Sell | Luminesce - Daily Moisturizing Complex
...ppearance. LUMINESCE daily moisturizing complex contain over 200 key human growth factors that encourage your body’s natural processes to produce more prote... ...t exposure to harmful UVA/UVB rays
• Contains an exclusive patent pending formula derived from adult stem cell containing 200+ key human growth factors that...
Posted on: 2013-11-06 from Indonesia - Raya
|
 |
| 0 | Sell | Luminesce - Cellular Rejuvenation Serum
...ding formula derived from adult stem cells that contain over 200 key human growth factor, LUMINESCE cellular rejuvenation serum gently transforms your skin ... ... replenish, amplify, and heal your skin. Using an exclusive patent-pending formula derived from adult stem cells that contain over 200 key human growth facto...
Posted on: 2013-11-06 from Indonesia - Raya
|
|
| 0 | Sell | Cracked polish
...utiful
lines and high adhension. 4. Strengthen nails and promote
nail growth. 5. Containing ingredients of
maintenance and good for nail
care. 6.... ...r nail
care. 6. Harmless and environmentally
friendly. 7. add unique formula to extend
the life of your manicure.
Posted on: 2013-02-27 from China - Guangdong
|
|
| 0 | Sell | FEG eyelash growth 100% Natural herbal formula eyelash enhancer
Rich in growth factor, activate
follicular cell. Function FEG can activate
dormant h... ...after 20 days’
usage of the product. Comprehensive nutrition, natural formula
Dosage Apply nightly directly to
the skin of the upper eyelid
margin ...
Posted on: 2013-08-13 from China - Guangdong
|
|
| 0 | Sell | Stevia extract 80-97% Stevioside, 40-97% Rebaudioside-A Reb-A
... low Calories
-- Resisting Carious teeth
-- Extend shelf-life by inhibit growth of bacteria ...rt Used: The dried whole plant
Extract Solution: Grain alcohol
Molecular formula and weight: C30H60O18, 804.88/C44H70O23, 967.02
Melting Point: 196℃...
Posted on: 2013-03-12 from China - Hunan
|
|
| 0 | Sell | Crackle nail polish
...utiful
lines and high adhension. 4. Strengthen nails and promote
nail growth. 5. Containing ingredients of
maintenance and good for nail
care. 6.... ...r nail
care. 6. Harmless and environmentally
friendly. 7. add unique formula to extend
the life of your manicure.
Posted on: 2012-11-29 from China - Guangdong
|
|
| 0 | Sell | Waterproof Mascara, Bring Long Lashes Liquid Extender serum
...darkkkkker!
bushierrrrrrrr! eyelashes that you dreamed of!
FEG Eyelash Growth Liquid, the best selling brand of cosmeceutical industry, are especially d... 10 amino acid formula
no drug, no harm
eyelashes extend 2-3mm in a week
3-7 days get effect
...
Posted on: 2013-01-07 from China - Yunnan
|
|
| 0 | Sell | China Noni Extract
...mptoms/Pain
• Enhance Cellular Health
• Inhibits pre-cancer function and growth of cancer tumors
• Strengthen Immune System
• Increases body energy
• A... ...istic
Active Ingredient: Polysaccharide9%-12%
glucosefructose
Molecular formula：C5H12O6
Molecular weight:152
Solubility: solubility in water
Fun...
Posted on: 2012-08-27 from China - Hunan
|
|
| 0 | Sell | Allantoin
...ing point: 232℃～240℃ Uses: With the promotion of cell growth and promote wound healing, softening keratin, and other physiological func... Product Name: Allantoin
Molecular Formula: C4H6N4O3
Structural Formula: Molecular Weight (Formula Weight):158.12
Appearance: white crystal powd...
Posted on: 2011-12-28 from China - Shaanxi
|
|
| 0 | Sell | Galacto Oligosaccharide powder any syrup
...ible food ingredients that beneficially affect the host by stimulating the growth and/or activity of beneficial bacteria in the colon. GOS naturally occurs ... ...s are broadly used in food for both infants and adult, ranging from infant formula to biscuits to food for the critical ill. They are widely recognized as th...
Posted on: 2011-07-14 from China - Shandong
|
|
| 0 | Sell | Sell quick hair regrowth products hair loss stop in one week
...melanin synthesis
5. Improves
Characteristics: 1. Anti loss and help growth safely without side-effect
2. Repair follicle cells, increase growth
3... ...p
2. Enhances Hair Follicles and Roots
3. Stimulants roots with secret formula
4. Accelerates melanin synthesis
5. Improves
Characteristics: 1. A...
Posted on: 2010-11-26 from China - Beijing
|
|
| 0 | Sell | Sell Effective hair regrowth products OEM service
...melanin synthesis
5. Improves
Characteristics: 1. Anti loss and help growth safely without side-effect
2. Repair follicle cells, increase growth
3... ...p
2. Enhances Hair Follicles and Roots
3. Stimulants roots with secret formula
4. Accelerates melanin synthesis
5. Improves
Characteristics: 1. A...
Posted on: 2010-11-16 from China - Beijing
|
|
| 0 | Sell | Amazing effect fast hair growth spray and pills
Fast hair growth products, hair growth within one week
Hair growth safely without side-effect
Herbal hair growth formula, Hair growth effec... ...hin one week
Hair growth safely without side-effect
Herbal hair growth formula, Hair growth effectively
Characteristics
Anti hair loss and help hair...
Posted on: 2010-11-11 from China - Beijing
|
|
| 0 | Sell | Best hair growth pilatory fast hair loss treatment
Fast hair growth products, hair growth within one week
Hair growth safely without side-effect. Herbal hair growth formula, Hair growth effec... ...hin one week
Hair growth safely without side-effect. Herbal hair growth formula, Hair growth effectively
Characteristics: Anti hair loss and help hair...
Posted on: 2010-11-09 from China - Beijing
|
|
| 0 | Sell | Effective hair growth products hair loss treatment
...melanin synthesis
5. Improves
Characteristics: 1. Anti loss and help growth safely without side-effect
2. Repair follicle cells, increase growth
3... ...p
2. Enhances Hair Follicles and Roots
3. Stimulants roots with secret formula
4. Accelerates melanin synthesis
5. Improves
Characteristics: 1. A...
Posted on: 2010-11-09 from China - Beijing
|
|
| 0 | Sell | OEM/ODM of Herbal hair growth Spray 093
Stop hair loss quickly, fast effect on hair growth, no skin sting, no itching, private label service, good choice for hair ce... ..., OEM available. Private Label, GMP Manufacturer, best herbal hair growth formula, competitive price. 100% Herbal, potent hair loss treatment formula. We...
Posted on: 2015-11-24 from China - Yunnan
|
| |
| 0 | Sell | Private label for effective hair loss treatment 093
Stop hair loss quickly, fast effect on hair growth, no skin sting, no itching, private label service, good choice for hair ce... ..., OEM available. Private Label, GMP Manufacturer, best herbal hair growth formula, competitive price. 100% Herbal, potent hair loss treatment formula. We...
Posted on: 2015-11-24 from China - Yunnan
|
| |
| 0 | Sell | China effective hair loss treatment - Yuda pilatory (secret formula093
...a areata and alopecia totalis. It is the most effectual herbal hair growth product; Best effect, Lowest price with GMP Standard (OEM & ODM available... Herbal Hair loss treatment formula, anti hair-loss
Yuda Pilatory is effective for all kinds of hair-loss, su...
Posted on: 2015-11-23 from China - Yunnan
|
| |
| 0 | Sell | Natural Hair Grower That Works!
... natural active ingredients help reduce hair loss and promote natural hair growth. ...s. Ethmideen Hair Plus is an effective, safe and easy to use topical formula made of the nature's most powerful anti 5-Alpha reductase enzyme, these n...
Posted on: 2014-12-31 from Saudi Arabia - Makkah
|
 |
| 0 | Sell | Creatine Monohydrate-Desheng Nutrition
... top supplement; creatine is used to develop strength and stimulate muscle growth. It is found in muscles, the heart and brain tissue. It is a natural deriv... ...ts of the body. Although it comes in many different forms, the most common formula used for athletic purposes is creatine monohydrate. Creatine monohydrate...
Posted on: 2011-12-27 from China - Jiangsu
|
|
| |
|
| |
Related Site Sections:
|
Trade Leads Directory -> All Trade Leads
